AibGenesis™ Mouse Anti-fam192a Antibody (CBMOAB-75868FYA)


Cat: CBMOAB-75868FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75868FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO75868FYA 100 µg
MO-AB-03466H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03466C 100 µg
MO-AB-25748H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25748C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO75868FYA
SpecificityThis antibody binds to Zebrafish fam192a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fam192a Antibody is a mouse antibody against fam192a. It can be used for fam192a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:65774; fam192a; zgc:6577
UniProt IDQ6PHL2
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MADLSRKFVSESELDEKRKKRQEEWEKVRKPDDPEEAPEEEYDPRSLFERLQEQKDKKQEEYEEQFKFKNMVKGLDEDETSFLDEVSRKQSLIEKHRREEDAQEIKEYRSALQKLAATDSQKKESEKKAGPKPSEHRTSHLSQAHLLAGAVKRRSSSQSSEGSKKQKTEESVTGNGSQTEQTREDPKSPGTAANRSGVLHLPSAAVCVGILPGLGAYSGSSDSESSSDLEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry