Mouse Anti-fam58a Antibody (CBMOAB-75999FYA)


Cat: CBMOAB-75999FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75999FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes) WB, ELISA MO75999FYA 100 µg
MO-AB-15634W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15634W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes)
CloneMO75999FYA
SpecificityThis antibody binds to Zebrafish fam58a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fam58a Antibody is a mouse antibody against fam58a. It can be used for fam58a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-related protein FAM58A; fam58
UniProt IDQ503D6
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MSAHASTSAAANEARGRRSAEDVEYSKTHFRVCRFITETGVKLGMRSVPMATACVLYHRFFQSASLQIYEPYLVAMSAIHLAGKVEEQHLRTRDIINVCHRYFHPDSEPLELNGKFWELRDSIVQCELLILRQLNFQVTFEHPHKYLLHYLLSVRSLLNRHAWSRTPIAETALAVLKDSYHGSVCVRHRPQHLALTALYLALQTYGVQLPRGELEWWQVVCADITKAQIETIMSELLQLYDMEAKCT.
For Research Use Only | Not For Clinical Use.
Online Inquiry