AibGenesis™ Mouse Anti-FAM69C Antibody (CBMOAB-42494FYA)


Cat: CBMOAB-42494FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42494FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO42494FYA 100 µg
Inquiry
CBMOAB-76015FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76015FYA 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO42494FYA
SpecificityThis antibody binds to Rhesus FAM69C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the FAM69 family of cysteine-rich type II transmembrane proteins. These proteins localize to the endoplasmic reticulum but their specific functions are unknown. (From NCBI)
Product OverviewMouse Anti-Rhesus FAM69C Antibody is a mouse antibody against FAM69C. It can be used for FAM69C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM69C
UniProt IDF6SMJ5
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MVAGEVKSALGLELSNSSLGPWWPGRRGPRWRGQLASLWALLQQEEYVYFSLLQDLSPHVLPVLGSCGHFYAVEFLAAGSPHHRALFPLDRVPGAPGGGQARAISDIALSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTDDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry