AibGenesis™ Mouse Anti-FAM78A Antibody (CBMOAB-42513FYA)


Cat: CBMOAB-42513FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42513FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO42513FYA 100 µg
MO-AB-12342R Monoclonal Cattle (Bos taurus) WB, ELISA MO12342R 100 µg
MO-AB-21429W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21429W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO42513FYA
SpecificityThis antibody binds to Rhesus FAM78A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM78A Antibody is a mouse antibody against FAM78A. It can be used for FAM78A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM78A
UniProt IDF6Y0C3
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: RLKNIPLSSWELPDLQEGKIQAISDSDGVNYPWYGNTTETCTIVGPTKRDSKFIISMNDNFYPSVTWAVPVSESNVAKLTNIYRDQSFTTWLVATNTSTNDMIILQTLHWRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNANDAQVLMWRPKYGQPLVVIPPKHR.
For Research Use Only | Not For Clinical Use.
Online Inquiry