AibGenesis™ Mouse Anti-FBXO16 Antibody (CBMOAB-42671FYA)


Cat: CBMOAB-42671FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42671FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO42671FYA 100 µg
CBMOAB-76216FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76216FYA 100 µg
MO-AB-02581W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02581W 100 µg
MO-AB-12420R Monoclonal Cattle (Bos taurus) WB, ELISA MO12420R 100 µg
MO-AB-55307W Monoclonal Marmoset WB, ELISA MO55307W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Marmoset, Zebrafish (Danio rerio)
CloneMO42671FYA
SpecificityThis antibody binds to Rhesus FBXO16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus FBXO16 Antibody is a mouse antibody against FBXO16. It can be used for FBXO16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesF-box only protein 16; FBXO16
UniProt IDH9F6Z0
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: LSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHVTKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGQKALPPWRSSDKHPTDIIRFNYLDNCDPLETVWQGRKKRNEMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP.
For Research Use Only | Not For Clinical Use.
Online Inquiry