Mouse Anti-Fcer1a Antibody (MO-AB-25788H)


Cat: MO-AB-25788H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25788H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Horse (Equus caballus), Sheep (Ovis aries) WB, ELISA MO25788C 100 µg
MO-AB-44721W Monoclonal Horse (Equus caballus) WB, ELISA MO44721W 100 µg
MO-AB-12452R Monoclonal Cattle (Bos taurus) WB, ELISA MO12452R 100 µg
MO-AB-15229Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15229Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Horse (Equus caballus), Sheep (Ovis aries)
CloneMO25788C
SpecificityThis antibody binds to Rat Fcer1a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
Product OverviewThis product is a mouse antibody against Fcer1a. It can be used for Fcer1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHigh affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha; Fcer1a; Fce1a
UniProt IDP12371
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG.
See other products for " FCER1A "
For Research Use Only | Not For Clinical Use.
Online Inquiry