AibGenesis™ Mouse Anti-FDCSP Antibody (MO-AB-19205W)


Cat: MO-AB-19205W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19205W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO19205W 100 µg
Inquiry
MO-AB-25796H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25796C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO19205W
SpecificityThis antibody binds to Chimpanzee FDCSP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a small secreted protein that is expressed in follicular dendritic cells. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. (From NCBI)
Product OverviewMouse Anti-Chimpanzee FDCSP Antibody is a mouse antibody against FDCSP. It can be used for FDCSP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 4 open reading frame 7; FDCSP
UniProt IDH2QPL3
Protein RefseqThe length of the protein is 85 amino acids long.
The sequence is show below: MKKVLLLITAILAVAAGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry