Mouse Anti-Ferret CCL4 Antibody (MO-AB-34499W)


Cat: MO-AB-34499W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34499W
SpecificityThis antibody binds to Ferret CCL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL4 (C-C Motif Chemokine Ligand 4) is a Protein Coding gene. Diseases associated with CCL4 include Pulmonary Tuberculosis and Meningitis. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include identical protein binding and chemokine activity. An important paralog of this gene is CCL4L2.
Product OverviewMouse Anti-Ferret CCL4 Antibody is a mouse antibody against CCL4. It can be used for CCL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine (C-C motif) ligand 4; CCL4
UniProt IDD7F055
Protein RefseqThe length of the protein is 62 amino acids long.
The sequence is show below: CDRPFSPSHGFQPLCLLHPAEDSVTVLSLLVLVAAFSTPALSAPMGSDPPTACCFSYTLRKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry