Mouse Anti-Ferret CCL4 Antibody (MO-AB-34499W)
Cat: MO-AB-34499W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34499W |
Specificity | This antibody binds to Ferret CCL4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCL4 (C-C Motif Chemokine Ligand 4) is a Protein Coding gene. Diseases associated with CCL4 include Pulmonary Tuberculosis and Meningitis. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include identical protein binding and chemokine activity. An important paralog of this gene is CCL4L2. |
Product Overview | Mouse Anti-Ferret CCL4 Antibody is a mouse antibody against CCL4. It can be used for CCL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine (C-C motif) ligand 4; CCL4 |
UniProt ID | D7F055 |
Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: CDRPFSPSHGFQPLCLLHPAEDSVTVLSLLVLVAAFSTPALSAPMGSDPPTACCFSYTLRKI. |
See other products for " Ccl4 "
MO-AB-24589H | Mouse Anti-Rat Ccl4 Antibody (MO-AB-24589H) |
MO-AB-43931W | Mouse Anti-Horse CCL4 Antibody (MO-AB-43931W) |
MO-AB-09702R | Mouse Anti-Cattle CCL4 Antibody (MO-AB-09702R) |
CBMOAB-38539FYA | Mouse Anti-Rhesus CCL4 Antibody (CBMOAB-38539FYA) |
MO-AB-52456W | Mouse Anti-Marmoset CCL4 Antibody (MO-AB-52456W) |
MOFY-0722-FY199 | FITC conjugated antibody to CCL4 Antibody (MOFY-0722-FY199) |
MOFY-0722-FY434 | Rabbit Anti-CCL4 Antibody (MOFY-0722-FY434) |
MO-AB-01019Y | Mouse Anti-Chicken CCL4 Antibody (MO-AB-01019Y) |
MO-AB-10827Y | Mouse Anti-O. mykiss CCL4 Antibody (MO-AB-10827Y) |
MO-AB-27014W | Mouse Anti-Chimpanzee CCL4 Antibody (MO-AB-27014W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry