Mouse Anti-Ferret CCR4 Antibody (MO-AB-34508W)
Cat: MO-AB-34508W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34508W |
Specificity | This antibody binds to Ferret CCR4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCR4 (C-C Motif Chemokine Receptor 4) is a Protein Coding gene. Diseases associated with CCR4 include Cutaneous T Cell Lymphoma and Mycosis Fungoides. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and C-C chemokine receptor activity. An important paralog of this gene is CCR5. |
Product Overview | Mouse Anti-Ferret CCR4 Antibody is a mouse antibody against CCR4. It can be used for CCR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine (C-C motif) receptor 4; CCR4 |
UniProt ID | D7F087 |
Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: LTYGVITSLATWSVAVLASLPGLLFSTCYTERNHTYCKTKYSLNSTRWKVLSSLEINILGLVVPLGTMLFCYSMIIRTLQH. |
See other products for " CCR4 "
MO-AB-29433W | Mouse Anti-Dog CCR4 Antibody (MO-AB-29433W) |
MO-DKB-03575W | Rabbit Anti-CCR4 Antibody (Cat MO-DKB-03575W) |
CBMOAB-01139HCB | Mouse Anti-C. elegans CCR4 Antibody (CBMOAB-01139HCB) |
CBMOAB-25857FYC | Mouse Anti-Arabidopsis CCR4 Antibody (CBMOAB-25857FYC) |
MO-AB-09737R | Mouse Anti-Cattle CCR4 Antibody (MO-AB-09737R) |
CBMOAB-00632CR | Mouse Anti-Yeast CCR4 Antibody (CBMOAB-00632CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry