Mouse Anti-Ferret CCR4 Antibody (MO-AB-34508W)


Cat: MO-AB-34508W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34508W
SpecificityThis antibody binds to Ferret CCR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR4 (C-C Motif Chemokine Receptor 4) is a Protein Coding gene. Diseases associated with CCR4 include Cutaneous T Cell Lymphoma and Mycosis Fungoides. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and C-C chemokine receptor activity. An important paralog of this gene is CCR5.
Product OverviewMouse Anti-Ferret CCR4 Antibody is a mouse antibody against CCR4. It can be used for CCR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine (C-C motif) receptor 4; CCR4
UniProt IDD7F087
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: LTYGVITSLATWSVAVLASLPGLLFSTCYTERNHTYCKTKYSLNSTRWKVLSSLEINILGLVVPLGTMLFCYSMIIRTLQH.
For Research Use Only | Not For Clinical Use.
Online Inquiry