Mouse Anti-Ferret CD8 Antibody (MO-AB-34524W)


Cat: MO-AB-34524W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34524W
SpecificityThis antibody binds to Ferret CD8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions.
Product OverviewMouse Anti-Ferret CD8 Antibody is a mouse antibody against CD8. It can be used for CD8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD8 alpha chain; CD8
UniProt IDR4PK89
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: MMASRVTPLLLPLAXLLHAVAAAGPSQFRLSPAKVVGQLGEKVELQCEVLLPSAAPGCSWLLQKNEPAARPVFLMYLSQTRTKLADGLDSEQISGKKIRDTLYSLTLRRFRKEDEGYYFCSVLSNSVLYFSSFVPVFLPVKPTPTPAPRLPTRAPTNTSQPVSQRPGICRPPAGKPVEKGVLGFACEIYIWAPLAGTCAVLLLSLVITVICNHRNRRRVCKCPRPMPRQGGPGGKPSPSEKYV.
See other products for " CD8 "
MOFY-0522-FY70Mouse Anti-CD8 Antibody (MOFY-0522-FY70)
MOFY-0522-FY37Mouse Anti-CD8 Antibody (MOFY-0522-FY37)
MO-AB-01071YMouse Anti-Chicken CD8 Antibody (MO-AB-01071Y)
MO-AB-00185RMouse Anti-Medaka CD8 Antibody (MO-AB-00185R)
For Research Use Only | Not For Clinical Use.
Online Inquiry