Mouse Anti-Ferret GALT Antibody (MO-AB-34809W)


Cat: MO-AB-34809W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34809W
SpecificityThis antibody binds to Ferret GALT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGalactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Ferret GALT Antibody is a mouse antibody against GALT. It can be used for GALT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalactose-1-phosphate uridylyltransferase; EC 2.7.7.12; GALT
UniProt IDM3XYX9
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: MSRGGSIPEQRQQASEADAVATTFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPPLLTTVPRHDPHNPLCPGATRANGEVNPYYDGTFVFDNDFPALQPDAPNPGPSDHPLFQAEAARGVCKVMCFHPWSDVTLPLMSVPEIRTVIDAWASVTEELGARYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERTQRAYQSQRGEPLLMEYGHQELLRKERLVLTSEHWLVLVPFWAVWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPMGSDAGANWDHWQLHAHYYPPLLRSATIRKFMVGYEMLAQAQRDLTPEQAAERLRTLPEVHYRLGQKDRETATIA.
For Research Use Only | Not For Clinical Use.
Online Inquiry