Mouse Anti-Ferret IL1A Antibody (MO-AB-34962W)
Cat: MO-AB-34962W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34962W |
Specificity | This antibody binds to Ferret IL1A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. |
Product Overview | Mouse Anti-Ferret IL1A Antibody is a mouse antibody against IL1A. It can be used for IL1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interleukin 1 alpha; IL1A |
UniProt ID | D7F090 |
Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: PLHEDCMSLRTSETSKTSHLTFKEDVVMVAASGKILKKRRLSLDQFITDDDLEVITNDTEEEIMKPRSVA. |
See other products for " IL1A "
MO-AB-41869W | Mouse Anti-Guinea pig IL1A Antibody (MO-AB-41869W) |
MOFY-0722-FY59 | Mouse Anti-IL1a Antibody (MOFY-0722-FY59) |
MOFY-0722-FY227 | Rabbit Anti-IL1a Antibody (MOFY-0722-FY227) |
MO-AB-45134W | Mouse Anti-Horse IL1A Antibody (MO-AB-45134W) |
MO-AB-15762Y | Mouse Anti-Sheep IL1A Antibody (MO-AB-15762Y) |
MO-AB-31267W | Mouse Anti-Dog IL1A Antibody (MO-AB-31267W) |
MOFY-0622-FY5 | Mouse Anti-IL1a Antibody (MOFY-0622-FY5) |
MOFY-0622-FY104 | Rabbit Anti-IL1a Antibody (MOFY-0622-FY104) |
MO-AB-26493H | Mouse Anti-Rat Il1a Antibody (MO-AB-26493H) |
MO-AB-12519W | Mouse Anti-Chimpanzee IL1A Antibody (MO-AB-12519W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry