Mouse Anti-Ferret MED15 Antibody (MO-AB-35107W)


Cat: MO-AB-35107W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO35107W
SpecificityThis antibody binds to Ferret MED15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Ferret MED15 Antibody is a mouse antibody against MED15. It can be used for MED15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator complex subunit 15
UniProt IDG9KA56
Protein RefseqThe length of the protein is 531 amino acids long.
The sequence is show below: QQQHLIKLHHQNQQQIQQQQQLQRMAQLQLQQQQQQQQQALQAQPPLQQPPMQQPQPPPSQALPQQLQPMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRTPMVVQQPQVQPQVQQVQPQVQQQTAVPTAQASQIVGSGVQVSQNSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEDDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry