Mouse Anti-Ferret RETN Antibody (MO-AB-35584W)


Cat: MO-AB-35584W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO35584W
SpecificityThis antibody binds to Ferret RETN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-Ferret RETN Antibody is a mouse antibody against RETN. It can be used for RETN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesResistin
UniProt IDG9KKT8
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: MKALPLLLLPVLGLLVCGNSLCPVDKAISEKIQDDAPSLILETMRNFGLTCQSVTSRGDLATCPAGFAVTACTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLQTAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry