AibGenesis™ Mouse Anti-TP53 Antibody (MO-AB-35871W)
Cat: MO-AB-35871W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-35871W | Monoclonal | Ferret (Mustela Putorius Furo), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast, Zebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO35871W | 100 µg | ||
| CBMOAB-60875FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60875FYA | 100 µg | ||
| MO-NAB-00233W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast | WB, ELISA, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready | NW0129 | 100 µg | ||
| MO-AB-08917W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08917W | 100 µg | ||
| MO-AB-15903W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15903W | 100 µg | ||
| MO-AB-34316W | Monoclonal | Donkey (Equus asinus) | WB, ELISA | MO34316W | 100 µg | ||
| MO-AB-38782W | Monoclonal | Gorilla | WB, ELISA | MO38782W | 100 µg | ||
| MO-AB-43485W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43485W | 100 µg | ||
| MO-AB-22056R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22056R | 100 µg | ||
| MO-AB-08632H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08632C | 100 µg | ||
| MO-AB-10286Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10286Y | 100 µg | ||
| MO-AB-18041Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18041Y | 100 µg | ||
| MO-NAB-00332W | Monoclonal | Human (Homo sapiens), Zebrafish (Danio rerio) | WB, IF, IHC-P | NW0260 | 100 µg | ||
| MO-NAB-00484W | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA, IHC | NW0406 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Ferret (Mustela Putorius Furo), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast, Zebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
| Clone | MO35871W |
| Specificity | This antibody binds to Ferret TP53. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Cytoskeleton; Mitochondrion; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). (From NCBI) |
| Product Overview | Mouse Anti-Ferret TP53 Antibody is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cellular tumor antigen p53; TP53 |
| UniProt ID | M3YC88 |
| Protein Refseq | The length of the protein is 375 amino acids long. The sequence is show below: MQDPQSELTIDPPLSQETFSELWNLLPENNVLSPAVDELLSEGVNWLGEGSNDAPRMPATPAPAAPGPAPSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKLFCQLAKTCPVQLWVSSPPPADTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLIRVEGNLRAKYLDDRNTFRQSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSSSPPQKKKPLDGEYFTLQIRGLERYNMFRELNEALELKDALNGKEPGGSRPHSSHLKAKKGQSTSRHKKPMLKREGPDSD. |
See other products for " TP53 "
| MO-AB-66716W | AibGenesis™ Mouse Anti-TP53 Antibody (MO-AB-66716W) |
| MOFAB-026W | Rabbit Anti-tp53 Antibody (MOFAB-026W) |
| CBMOAB-10409FYB | AibGenesis™ Mouse Anti-tp53 Antibody (CBMOAB-10409FYB) |
| MO-AB-01778R | AibGenesis™ Mouse Anti-TP53 Antibody (MO-AB-01778R) |
| MO-AB-46888W | AibGenesis™ Mouse Anti-TP53 Antibody (MO-AB-46888W) |
| MO-NAB-00511W | AibGenesis™ Mouse Anti-TP53 Antibody (C-terminal) |
| MO-AB-33798W | AibGenesis™ Mouse Anti-TP53 Antibody (MO-AB-33798W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry