Mouse Anti-TP53 Antibody (MO-AB-46888W)


Cat: MO-AB-46888W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-46888W Monoclonal Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast, Zebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO46888W 100 µg
CBMOAB-60875FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60875FYA 100 µg
MO-NAB-00233W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast WB, ELISA, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready NW0129 100 µg
MO-AB-08917W Monoclonal Cat (Felis catus) WB, ELISA MO08917W 100 µg
MO-AB-15903W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15903W 100 µg
MO-AB-34316W Monoclonal Donkey (Equus asinus) WB, ELISA MO34316W 100 µg
MO-AB-38782W Monoclonal Gorilla WB, ELISA MO38782W 100 µg
MO-AB-43485W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43485W 100 µg
MO-AB-22056R Monoclonal Cattle (Bos taurus) WB, ELISA MO22056R 100 µg
MO-AB-08632H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08632C 100 µg
MO-AB-10286Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10286Y 100 µg
MO-AB-18041Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18041Y 100 µg
MO-NAB-00332W Monoclonal Human (Homo sapiens), Zebrafish (Danio rerio) WB, IF, IHC-P NW0260 100 µg
MO-NAB-00484W Monoclonal Zebrafish (Danio rerio) WB, ELISA, IHC NW0406 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Gorilla, Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Yeast, Zebrafish (Danio rerio), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO46888W
SpecificityThis antibody binds to Horse TP53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Endoplasmic reticulum; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). (From NCBI)
Product OverviewMouse Anti-Horse TP53 Antibody is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular tumor antigen p53; Tumor suppressor p53; TP53; P53
UniProt IDP79892
Protein RefseqThe length of the protein is280 amino acids long.
The sequence is show below: PAVNNLLLSPDVVNWLDEGPDEAPRMPAAPAPLAPAPATSWPLSSFVPSQKTYPGCYGFRLGFLNSGTAKSVTCTYSPTLNKLFCQLAKTCPVQLLVSSPPPPGTRVRAMAIYKKSEFMTEVVRRCPHHERCSDSSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRSTKRVLSSNTSSSPPQKKKPLDGEYFT.
For Research Use Only | Not For Clinical Use.
Online Inquiry