Mouse Anti-Ferret WNT8A Antibody (MO-AB-35993W)


Cat: MO-AB-35993W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO35993W
SpecificityThis antibody binds to Ferret WNT8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Ferret WNT8A Antibody is a mouse antibody against WNT8A. It can be used for WNT8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; WNT8A
UniProt IDM3YEA1
Protein RefseqThe length of the protein is 351 amino acids long.
The sequence is show below: MEDLFMLRVAVGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRAIMKRTCKCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRALKIEMDKRQLRAGNSAEGRWAPAEAFLPSAEAELIFLEESPDYCTRNSSLGISGTEGRECLQNSRNASRWEQRSCGRLCTECGLQVEERRTEAISSCNCKFQWCCTVRCDQCRRVVNRYYCSSSPGHAWSGRKASA.
For Research Use Only | Not For Clinical Use.
Online Inquiry