AibGenesis™ Mouse Anti-fgf16 Antibody (CBMOAB-76398FYA)
Cat: CBMOAB-76398FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-76398FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO76398FYA | 100 µg | ||
| MO-AB-00456L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00456L | 100 µg | ||
| MO-AB-00486R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00486R | 100 µg | ||
| MO-AB-01887Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01887Y | 100 µg | ||
| MO-AB-03578H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03578C | 100 µg | ||
| MO-AB-08073Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08073Y | 100 µg | ||
| MO-AB-09415W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09415W | 100 µg | ||
| MO-AB-11890W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11890W | 100 µg | ||
| MO-AB-12521R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12521R | 100 µg | ||
| MO-AB-15253Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15253Y | 100 µg | ||
| MO-AB-23216H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23216C | 100 µg | ||
| MO-AB-25812H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25812C | 100 µg | ||
| MO-AB-25824R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25824R | 100 µg | ||
| MO-AB-30773W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30773W | 100 µg | ||
| MO-AB-33091H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33091C | 100 µg | ||
| MO-AB-34752W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34752W | 100 µg | ||
| MO-AB-41646W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41646W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO76398FYA |
| Specificity | This antibody binds to Zebrafish fgf16. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of a family of proteins that are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene is expressed in cardiac cells and is required for proper heart development. Mutation in this gene was also observed in individuals with metacarpal 4-5 fusion. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish fgf16 Antibody is a mouse antibody against fgf16. It can be used for fgf16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Fibroblast growth factor; FGF; fgf1 |
| UniProt ID | Q2HXK8 |
| Protein Refseq | The length of the protein is 203 amino acids long. The sequence is show below: MAEVAGFLGSIDLDLQAFPALGNVPLSDGLNERLGLIEGRLQRGSLTDFGHLKGILRRRQLYCRTGFQLEIFPNGTVHGTRQDHSRFGILEFISLAVGLVSIRGVDAGLYLGMNEKGELYGSKKLTAECVFREQFEENWYNTYASTLFKHADTGRYYYVALNKDGSPREGSRTKKHQKLTHFLPRPVEIEKIPQAYRELFQHR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry