Mouse Anti-FGF9 Antibody (CBMOAB-42862FYA)


Cat: CBMOAB-42862FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42862FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO42862FYA 100 µg
CBMOAB-76440FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76440FYA 100 µg
MO-AB-00468L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00468L 100 µg
MO-AB-01899Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01899Y 100 µg
MO-AB-03588H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03588C 100 µg
MO-AB-06484Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06484Y 100 µg
MO-AB-08085Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08085Y 100 µg
MO-AB-12544R Monoclonal Cattle (Bos taurus) WB, ELISA MO12544R 100 µg
MO-AB-13007W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13007W 100 µg
MO-AB-15274Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15274Y 100 µg
MO-AB-23223H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23223C 100 µg
MO-AB-25830H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25830C 100 µg
MO-AB-30792W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30792W 100 µg
MO-AB-34765W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34765W 100 µg
MO-AB-38554W Monoclonal Gorilla WB, ELISA MO38554W 100 µg
MO-AB-44749W Monoclonal Horse (Equus caballus) WB, ELISA MO44749W 100 µg
MO-AB-55431W Monoclonal Marmoset WB, ELISA MO55431W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO42862FYA
SpecificityThis antibody binds to Rhesus FGF9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis.
Product OverviewMouse Anti-Rhesus FGF9 Antibody is a mouse antibody against FGF9. It can be used for FGF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFibroblast growth factor; FGF; FGF9
UniProt IDH9FAE4
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: GILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry