Mouse Anti-FGF9 Antibody (CBMOAB-42862FYA)
Cat: CBMOAB-42862FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-42862FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO42862FYA | 100 µg | ||
CBMOAB-76440FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76440FYA | 100 µg | ||
MO-AB-00468L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00468L | 100 µg | ||
MO-AB-01899Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01899Y | 100 µg | ||
MO-AB-03588H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03588C | 100 µg | ||
MO-AB-06484Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06484Y | 100 µg | ||
MO-AB-08085Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08085Y | 100 µg | ||
MO-AB-12544R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12544R | 100 µg | ||
MO-AB-13007W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13007W | 100 µg | ||
MO-AB-15274Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15274Y | 100 µg | ||
MO-AB-23223H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23223C | 100 µg | ||
MO-AB-25830H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25830C | 100 µg | ||
MO-AB-30792W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30792W | 100 µg | ||
MO-AB-34765W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34765W | 100 µg | ||
MO-AB-38554W | Monoclonal | Gorilla | WB, ELISA | MO38554W | 100 µg | ||
MO-AB-44749W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44749W | 100 µg | ||
MO-AB-55431W | Monoclonal | Marmoset | WB, ELISA | MO55431W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO42862FYA |
Specificity | This antibody binds to Rhesus FGF9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. |
Product Overview | Mouse Anti-Rhesus FGF9 Antibody is a mouse antibody against FGF9. It can be used for FGF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fibroblast growth factor; FGF; FGF9 |
UniProt ID | H9FAE4 |
Protein Refseq | The length of the protein is 116 amino acids long. The sequence is show below: GILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry