Mouse Anti-FKBP1B Antibody (CBMOAB-42927FYA)


Cat: CBMOAB-42927FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42927FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO42927FYA 100 µg
CBMOAB-76576FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76576FYA 100 µg
MO-AB-00477L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00477L 100 µg
MO-AB-00509R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00509R 100 µg
MO-AB-03619H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03619C 100 µg
MO-AB-07552W Monoclonal Cat (Felis catus) WB, ELISA MO07552W 100 µg
MO-AB-08098Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08098Y 100 µg
MO-AB-12593R Monoclonal Cattle (Bos taurus) WB, ELISA MO12593R 100 µg
MO-AB-15285Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15285Y 100 µg
MO-AB-18511W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18511W 100 µg
MO-AB-25853H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25853C 100 µg
MO-AB-25858R Monoclonal Pig (Sus scrofa) WB, ELISA MO25858R 100 µg
MO-AB-30811W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30811W 100 µg
MO-AB-34771W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34771W 100 µg
MO-AB-55506W Monoclonal Marmoset WB, ELISA MO55506W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO42927FYA
SpecificityThis antibody binds to Rhesus FKBP1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Product OverviewMouse Anti-Rhesus FKBP1B Antibody is a mouse antibody against FKBP1B. It can be used for FKBP1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeptidyl-prolyl cis-trans isomerase; FKBP1B
UniProt IDH9ERU1
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLRPLSPLPICPHPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry