Mouse Anti-FKBP1B Antibody (CBMOAB-42927FYA)
Cat: CBMOAB-42927FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-42927FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO42927FYA | 100 µg | ||
CBMOAB-76576FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76576FYA | 100 µg | ||
MO-AB-00477L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00477L | 100 µg | ||
MO-AB-00509R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00509R | 100 µg | ||
MO-AB-03619H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03619C | 100 µg | ||
MO-AB-07552W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07552W | 100 µg | ||
MO-AB-08098Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08098Y | 100 µg | ||
MO-AB-12593R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12593R | 100 µg | ||
MO-AB-15285Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15285Y | 100 µg | ||
MO-AB-18511W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18511W | 100 µg | ||
MO-AB-25853H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25853C | 100 µg | ||
MO-AB-25858R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25858R | 100 µg | ||
MO-AB-30811W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30811W | 100 µg | ||
MO-AB-34771W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34771W | 100 µg | ||
MO-AB-55506W | Monoclonal | Marmoset | WB, ELISA | MO55506W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO42927FYA |
Specificity | This antibody binds to Rhesus FKBP1B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. (From NCBI) |
Product Overview | Mouse Anti-Rhesus FKBP1B Antibody is a mouse antibody against FKBP1B. It can be used for FKBP1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Peptidyl-prolyl cis-trans isomerase; FKBP1B |
UniProt ID | H9ERU1 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLRPLSPLPICPHPC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry