AibGenesis™ Mouse Anti-Fl(2)D Antibody (CBMOAB-16856FYA)


Cat: CBMOAB-16856FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16856FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO16856FYA 100 µg
MO-NAB-00782W Monoclonal D. melanogaster (Drosophila melanogaster) IHC, IP, WB NW0704 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO16856FYA
SpecificityThis antibody binds to fruit fly Fl(2)D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAssociated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and is required for sex determination (PubMed:27919077). Required for sex determination and dosage compensation via Sxl alternative splicing: m6A methylation acts as a key regulator of Sxl pre-mRNA and promotes female-specific alternative splicing of Sxl, which determines female physiognomy (PubMed:1695150, PubMed:27919077). M6A methylation is also required for neuronal functions (PubMed:27919077). Required for proper inclusion of regulated exons in Ubx transcripts, leading to isoforms Ia/b and IIa/b (PubMed:10101174). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Fl(2)D Antibody is a mouse antibody against Fl(2)D. It can be used for Fl(2)D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPre-mRNA-splicing regulator female-lethal(2)D; dFL(2)D; fl(2)d
UniProt IDQ9Y091
Protein RefseqThe length of the protein is 536 amino acids long.
The sequence is show below: MSVAAMTMDDQRPCMNSYDKMPPTKYEQNLNILNSSQNSGATGGPASPTPSGLEDHHHHHHPHPHHHHHQEQQQQQQQQQHLQQQQQQQQQQHAAAVAEAVAAAEQRQRLLEDEIENLKLEQVRMAQQCADAQRREKILMRRLANKEQEFQDYVSQIAEYKAQQAPTALALRTALLDPAVNLLFERLKKELKATKAKLEETQNELSAWKFTPDSNTGKRLMAKCRLLYQENEELGKMTSNGRLAKLETELAMQKSFSEEVKKSQSELDDFLQELDEDVEGMQSTILFLQQELKTTRDRIQTLEKENAQLKQAIKDEVVAPAAATNGGTNTTINKLETIHEDACMANNPTNPDCYNGNTNNEQIAAVPQIPLSDDGSNMNGNAARLARKRNYQEEEALPTVVVVPTPTPVGNNVQEAPPIREVTAPRTLPPKKSKLRGITTRRNSQLEEDHQPVTTPVAVPMIVDNAVAGMASEEAAAAAAAVNNSNTGIIPETGVQVGVPVEGGDPGAPAAPGRILTRRRSVRMQQNGSGAVDYST.
For Research Use Only | Not For Clinical Use.
Online Inquiry