Mouse Anti-FLOT2 Antibody (MO-AB-12630R)


Cat: MO-AB-12630R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12630R Monoclonal Cattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza) WB, ELISA MO12630R 100 µg
CBMOAB-33375FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO33375FC 100 µg
CBMOAB-42981FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42981FYA 100 µg
CBMOAB-22727FYB Monoclonal Rice (Oryza) WB, ELISA MO22727FYB 100 µg
MO-AB-55540W Monoclonal Marmoset WB, ELISA MO55540W 100 µg
MO-AB-03639H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03639C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza)
CloneMO12630R
SpecificityThis antibody binds to Cattle FLOT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle FLOT2 Antibody is a mouse antibody against FLOT2. It can be used for FLOT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFlotillin-2; FLOT2
UniProt IDA6QLR4
Protein RefseqThe length of the protein is 428 amino acids long.
The sequence is show below: MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKSVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQE.
See other products for " FLOT2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry