AibGenesis™ Mouse Anti-FPGS Antibody (CBMOAB-43127FYA)


Cat: CBMOAB-43127FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43127FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO43127FYA 100 µg
CBMOAB-76930FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76930FYA 100 µg
MO-AB-00485L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00485L 100 µg
MO-AB-00521R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00521R 100 µg
MO-AB-02599W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02599W 100 µg
MO-AB-09134W Monoclonal Cat (Felis catus) WB, ELISA MO09134W 100 µg
MO-AB-12691R Monoclonal Cattle (Bos taurus) WB, ELISA MO12691R 100 µg
MO-AB-15301Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15301Y 100 µg
MO-AB-24427W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24427W 100 µg
MO-AB-25904R Monoclonal Pig (Sus scrofa) WB, ELISA MO25904R 100 µg
MO-AB-30833W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30833W 100 µg
MO-AB-33117H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33117C 100 µg
MO-AB-34779W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34779W 100 µg
MO-AB-41669W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41669W 100 µg
MO-AB-43145W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43145W 100 µg
MO-AB-44793W Monoclonal Horse (Equus caballus) WB, ELISA MO44793W 100 µg
MO-AB-55634W Monoclonal Marmoset WB, ELISA MO55634W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO43127FYA
SpecificityThis antibody binds to Rhesus FPGS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. Alternative splicing results in transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus FPGS Antibody is a mouse antibody against FPGS. It can be used for FPGS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFPGS
UniProt IDF7A8Y4
Protein RefseqThe length of the protein is 375 amino acids long.
The sequence is show below: MSRARNHLRAALFLAAASARGVTTQVAAQRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISVNGRADHPGRGSCGSCPWHPCSSPHPTCGSGFGTRSGWGGHRCCGAGPLPGTWTARTPPAACRPACAGSARRCRAERGRAVGPRFESCSSMLPGTGTRRPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry