Mouse Anti-French-bean DGL1 Antibody (MO-AB-36174W)
Cat: MO-AB-36174W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | French-bean |
| Clone | MO36174W |
| Specificity | This antibody binds to French-bean DGL1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Endoplasmic reticulum |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (GlcManGlcNAc in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-French-bean DGL1 Antibody is a mouse antibody against DGL1. It can be used for DGL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; Oligosaccharyl transferase 48 kDa subunit; EC 2.4.99.18; DGL1 |
| UniProt ID | H9N311 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: HEKSGNEQFFTELSKWVFHERGHLKAVHMQHHKVGEANEPAIYRINDDLEFSVEIFEWSGTSWEPYVDDDVQVQFYMMSP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry