Mouse Anti-French-bean NPR1 Antibody (MO-AB-36325W)
Cat: MO-AB-36325W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | French-bean |
Clone | MO36325W |
Specificity | This antibody binds to French-bean NPR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively). |
Product Overview | Mouse Anti-French-bean NPR1 Antibody is a mouse antibody against NPR1. It can be used for NPR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative regulatory protein NPR1; NPR1 |
UniProt ID | Q3LFQ2 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: AXDSDDVVLVKLLLNESEITLDEAHALHYAAAYCDPKVVSEVLGLGLANVNQGI. |
See other products for " NPR1 "
MO-AB-16356Y | Mouse Anti-Sheep NPR1 Antibody (MO-AB-16356Y) |
MO-DKB-04071W | Rabbit Anti-NPR1 (Center) Antibody (Cat MO-DKB-04071W) |
MO-AB-27814R | Mouse Anti-Pig NPR1 Antibody (MO-AB-27814R) |
MO-AB-08981Y | Mouse Anti-Rabbit NPR1 Antibody (MO-AB-08981Y) |
CBMOAB-07696HCB | Mouse Anti-C. elegans NPR1 Antibody (CBMOAB-07696HCB) |
MO-AB-00912L | Mouse Anti-Elephant NPR1 Antibody (MO-AB-00912L) |
MO-AB-32222W | Mouse Anti-Dog NPR1 Antibody (MO-AB-32222W) |
MO-AB-05733H | Mouse Anti-Frog npr1 Antibody (MO-AB-05733H) |
MO-AB-08689W | Mouse Anti-Cat NPR1 Antibody (MO-AB-08689W) |
MO-AB-16887R | Mouse Anti-Cattle NPR1 Antibody (MO-AB-16887R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry