Mouse Anti-French-bean NPR1 Antibody (MO-AB-36325W)


Cat: MO-AB-36325W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrench-bean
CloneMO36325W
SpecificityThis antibody binds to French-bean NPR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGuanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).
Product OverviewMouse Anti-French-bean NPR1 Antibody is a mouse antibody against NPR1. It can be used for NPR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative regulatory protein NPR1; NPR1
UniProt IDQ3LFQ2
Protein RefseqThe length of the protein is 54 amino acids long.
The sequence is show below: AXDSDDVVLVKLLLNESEITLDEAHALHYAAAYCDPKVVSEVLGLGLANVNQGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry