Mouse Anti-Frog aadacl4 Antibody (MO-AB-01112H)


Cat: MO-AB-01112H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01112C
SpecificityThis antibody binds to Frog aadacl4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAADACL4 (Arylacetamide Deacetylase Like 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity and carboxylic ester hydrolase activity. An important paralog of this gene is AADACL3.
Product OverviewThis product is a mouse antibody against aadacl4. It can be used for aadacl4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC495387 protein; aadacl4; LOC495387
UniProt IDQ5U529
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MISIAILGKIFQNLGLCNPVNFTRYVREQLMVGKLGEDPKLFIKDQQFENVPVRVYQPRLPSAGGRKGVMFFHGGGWMFGSIDTYDKLCRYISKETETVVVSVGYRLAPEHRYPAGYEDCLNATVHFLKTAKEFGVDPSSVIISGDSAGGNLTAAVCQSLVNKTDLPKPLAQVLIYPAVQMIDFDLPSYQQNRAVPVLYRERAAFYMLNYISDDLSSLEEMLDGDHIPVETKMKYRKWLSAENIPDEFKVRGFKPRVMSSQAEEVIEEVKSALETACSPLLAEDSVIRLQPQAYILTCEFDVLRDDGLLYKKRLEDNGVPVTWYHVKDGFHGIVSFFDNGNLSFPSGKLAIESIASYIKNA.
For Research Use Only | Not For Clinical Use.

Online Inquiry