Mouse Anti-Frog abhd5 Antibody (MO-AB-01144H)


Cat: MO-AB-01144H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01144C
SpecificityThis antibody binds to Frog abhd5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Product OverviewThis product is a mouse antibody against abhd5. It can be used for abhd5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhd5-prov protein; abhd5; abhd5-prov
UniProt IDQ6DFC5
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MAEGSDMVSSYSERGLIGALRAAVWSFVSGWLSSWLPAWCPTSIPHLKEAEEKMLKSITRTYSKEHILISGGNKVWTLAFKQPLSNKTPLVLLHGFGGGVGLWVLNFENICQDRTVYACDILGFGRSSRPHFQGDAEKAEEQFVQSIEEWRKELGLEKMIFLGHNLGAFLASAYSLKYPSRVKSLILVEPWGFPDRPDNADEGRPIPIWIKAVGAMLSPFNPLAGLRLAGPLGLSLVQRLRPDFKKKYSSMFDDDTVTEYIYHCNAQSPSGETAFRNMTVPYGWAQRPMLQRIDKMHLDIPITVIYGARSCIDGNSGSTIQSLRPNSYVKTIAIRGAGHYVFADQPEDFNQKVTEICDSVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry