Mouse Anti-Frog abi2 Antibody (MO-AB-01146H)


Cat: MO-AB-01146H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01146C
SpecificityThis antibody binds to Frog abi2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).
Product OverviewThis product is a mouse antibody against abi2. It can be used for abi2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesXenopus laevis animal 4; Xlan4; abi2
UniProt IDQ03292
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MKMGGLPRTTPPTQKPPSPPMTGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPPQQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPGNPAQFYSMNRPVSRHNPPSIGGSLPYRRPPSLTSQPSLQNQINGGPFYSQNIVSHAPPPPSILQVTPQLPLMGFVARVQENITETPPPPPPAEEPVFDESPPPPPQDYEEEEAAVVEYSDPYAEEDPSWAPRTYLEKVVAIYDYAKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE.
See other products for " ABI2 "
CBMOAB-34879FYAMouse Anti-Rhesus ABI2 Antibody (CBMOAB-34879FYA)
MOFAB-610WMouse Anti-Arabidopsis ABI2 Antibody (MOFAB-610W)
MO-DKB-0009RARabbit Anti-ABI2 Antibody (MO-DKB-0009RA)
MO-AB-47181WMouse Anti-Maize ABI2 Antibody (MO-AB-47181W)
MO-AB-06810RMouse Anti-Cattle ABI2 Antibody (MO-AB-06810R)
MO-AB-28221WMouse Anti-Cucumber ABI2 Antibody (MO-AB-28221W)
CBMOAB-1380FYCMouse Anti-Arabidopsis ABI2 Antibody (CBMOAB-1380FYC)
MO-AB-50243WMouse Anti-Marmoset ABI2 Antibody (MO-AB-50243W)
MO-AB-11720WMouse Anti-Chimpanzee ABI2 Antibody (MO-AB-11720W)
For Research Use Only | Not For Clinical Use.
Online Inquiry