Mouse Anti-Frog add1 Antibody (MO-AB-01244H)


Cat: MO-AB-01244H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01244C
SpecificityThis antibody binds to Frog add1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdducins are a family of cytoskeletal proteins encoded by three genes (alpha, beta, and gamma). Adducin acts as a heterodimer of the related alpha, beta, or gamma subunits. The protein encoded by this gene represents the alpha subunit. Alpha- and beta-adducin include a protease-resistant N-terminal region and a protease-sensitive, hydrophilic C-terminal region. Adducin binds with high affinity to Ca(2+)/calmodulin and is a substrate for protein kinases A and C.
Product OverviewThis product is a mouse antibody against add1. It can be used for add1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdd1-a protein; add1; add1-a
UniProt IDQ802B6
Protein RefseqThe length of the protein is 799 amino acids long.
The sequence is show below: MNGDSSVGVVTTPPPTNPPHKEKYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCDELETLIQDQFKKGKNPTGLLALQQIADFMTTGVPNVYPSAPQGGMASLNLSLGMVTPVNDLRGSDSIAYEKGEKLLRCKLAAFYRLADLFGWSQLIYNHITVRVNSEQEYFLIVPFGLLYSEVTASSLVKINLQGELVDRGSTNLGVNKAGFTLHSAIYAARPDVKCIVHIHTPAGAAVSAMKCGLLPLSPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILRNHGLVTMGETVEEAFYYIHNLMAACEIQVRTLASAGGPDNLVLLDPAKYKKSRSPETPSGEGSGLHPKWLVGEQEFEALMRMLDNLGYRTGYPYRCPALREKAKKYSDVEIPASVTGYSLGNDGGSGTCSPLRHSFQKQQREKTKWLNSGRADDTSEDGQNGGSPKSKTKWTKEDGMKSATSAVPNMFVPMNTDPKEVQEMRNKIRDQNLQDIKTAGPQSQLLCGVVVDRSIVQGELVTASKAIIEKEYQPKMIVSSTGPNPFNRFSERELEEYHKEIERKHKDAEDELSQCGETAVPQPSLQEDVSKENSRGPNGEPAKSQSEAEITEQIHKSLAEVNDCAEQLEEAEEVKEAPAEHIDTPPSTPIKPEEESQQEQTYKDDSDAATFKQTLPDLTPDEPSEELAIPISGNEGDEQSVPCDRDITKAPTESAHEEAEPQLVDPPTIPTAEEPVQTDPAPADASLVDAGSDESPGKSPSKKKKKFRTPSFLKKNKKKSES.
See other products for " ADD1 "
MO-DKB-01232WRabbit Anti-ADD1 Antibody (MO-DKB-01232W)
CBMOAB-64992FYAMouse Anti-Zebrafish add1 Antibody (CBMOAB-64992FYA)
CBMOAB-35209FYAMouse Anti-Rhesus ADD1 Antibody (CBMOAB-35209FYA)
MO-AB-20793WMouse Anti-Chimpanzee ADD1 Antibody (MO-AB-20793W)
MO-AB-00949WMouse Anti-Rhesus ADD1 Antibody (MO-AB-00949W)
MO-AB-23543RMouse Anti-Pig ADD1 Antibody (MO-AB-23543R)
CBMOAB-00375HCBMouse Anti-C. elegans ADD1 Antibody (CBMOAB-00375HCB)
CBMOAB-00702FYAMouse Anti-D. melanogaster Add1 Antibody (CBMOAB-00702FYA)
MO-AB-22811HMouse Anti-Mallard ADD1 Antibody (MO-AB-22811H)
MO-AB-50485WMouse Anti-Marmoset ADD1 Antibody (MO-AB-50485W)
For Research Use Only | Not For Clinical Use.
Online Inquiry