Mouse Anti-Frog ank1 Antibody (MO-AB-01416H)
Cat: MO-AB-01416H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Frog (Xenopus laevis) |
| Clone | MO01416C |
| Specificity | This antibody binds to Frog ank1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highly conserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subject to variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. |
| Product Overview | This product is a mouse antibody against ank1. It can be used for ank1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | LOC100036926 protein; ank1; LOC100036926 |
| UniProt ID | A1L2R2 |
| Protein Refseq | The length of the protein is 183 amino acids long. The sequence is show below: MWGFLTELGVCIVLIGFFVVSCQNVVHIVRGAGKFVLRRLHSELDKELGEGGGEDDEETLTTKVVRRRVIVKGNEVPDIPGEQVTEEEFTDEQGNIVTKKIVRKVLRRVGPPGTTDLGDNEDLLIEGTLQEPEDLESETPNYLKYAVLHREAEDENDTVRSEVADGRKGAQIVKRAGTKRVQQ. |
See other products for " ANK1 "
| MO-AB-01040W | Mouse Anti-Rhesus ANK1 Antibody (MO-AB-01040W) |
| CBMOAB-35641FYA | Mouse Anti-Rhesus ANK1 Antibody (CBMOAB-35641FYA) |
| MO-AB-07350R | Mouse Anti-Cattle ANK1 Antibody (MO-AB-07350R) |
| MO-AB-43659W | Mouse Anti-Horse ANK1 Antibody (MO-AB-43659W) |
| MO-AB-50838W | Mouse Anti-Marmoset ANK1 Antibody (MO-AB-50838W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry