Mouse Anti-Frog apcs Antibody (MO-AB-01480H)


Cat: MO-AB-01480H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01480C
SpecificityThis antibody binds to Frog apcs.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.
Product OverviewThis product is a mouse antibody against apcs. It can be used for apcs detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC100049775 protein; apcs; LOC100049775
UniProt IDA5D8Q5
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MAQKDMDRNIFFFPKRSVNDYVLLTPTMTGSLNKFTVCLRSYAQHGHSALFIVGNPESKIHNMFVVYQSSLTYSQPYFDSSIYINNSQVCITAKADVLQSIHRCVTWDSDTGVLQHWVNGKVSPLAVLQRGFSIDLQDGISLGQMRRNGATGWNFTASFQGEISDVHMWNSVLSPETIGKVLLNNINGNVISWRSLSYTIKGDVIVQPKLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry