Mouse Anti-Frog best2 Antibody (MO-AB-01837H)


Cat: MO-AB-01837H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01837C
SpecificityThis antibody binds to Frog best2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the bestrophin gene family of anion channels. Bestrophin genes share a similar gene structure with highly conserved exon-intron boundaries, but with distinct 3' ends. Bestrophins are transmembrane proteins that contain a homologous region rich in aromatic residues, including an invariant arg-phe-pro motif. Mutation in one of the family members (bestrophin 1) is associated with vitelliform macular dystrophy. The bestrophin 2 gene is mainly expressed in the retinal pigment epithelium and colon.
Product OverviewThis product is a mouse antibody against best2. It can be used for best2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBestrophin-2a; MGC53680 protein; best2; MGC53680 VMD2L1
UniProt IDQ7ZT25
Protein RefseqThe length of the protein is 512 amino acids long.
The sequence is show below: MTVTYTARVANARFGGFYKLLLLWRGSIYKLLYKEFLAFLIMYLGLSIIYRFLLNDEQRLYFEKVAIYCNNYANLIPVSFVLGFYVTLVVNRWWNQYLCMPFPDRVMCAVSGTVHGSDETGRLYRRTLIRYCSLSGLLILRSVSTAVFKRFPTIDHVVEAGFMTRLERKKFENLQSSYNKYWVPCVWFCNLAAQARSEGRIRDDHSFKMLMEELNTFRGNCGMLFHYDWISIPLVYTQVVTIAVYSFFLTCLIGRQFLDPSRGYPGHELDLYIPVFTLLQFFFYAGWLKVGEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYSDVPPMEKDRYWNHSDPRPPYTAATLFQKHLPSFQGSTFNMAIPKEDMQFQPLSDIEEMNEDTLMHPLPLLSRFLPGVGPSPLSSSAALAAQFAAPENNFTLLRRSTSAFSSSSEFQSQEPIQDPPYNLVDTKTPELNVQECQIEKQFSVGSQVSLFLPPKTMDIDGNIQSVMPEEEEDTASLVAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry