Mouse Anti-Frog bmp4 Antibody (MO-AB-01890H)


Cat: MO-AB-01890H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01890C
SpecificityThis antibody binds to Frog bmp4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Product OverviewThis product is a mouse antibody against bmp4. It can be used for bmp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBone morphogenetic protein 4; bmp4; Bmp4
UniProt IDB7ZPR8
Protein RefseqThe length of the protein is 401 amino acids long.
The sequence is show below: MIPGNRMLMVILLSQVLLGGTNYASLIPDTGKKKVAADIQGGGRRSPQSNELLRDFEVTLLQMFGLRKRPQPSKDVVVPAYMRDLYRLQSAEEEDELHDISMEYPETPTSRANTVRSFHHEEHLENLPGTEENGNFRFVFNLSSIPENEVISSAELRLYREQIDHGPAWDEGFHRINIYEVMKPITANGHMINRLLDTRVIHHNVTQWESFDVSPAIMRWTLDKQINHGLAIEVIHLNQTKTYQGKHVRISRSLLPQKDADWSQMRPLLITFSHDGRGHALTRRSKRSPKQQRPRKKNKHCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry