Mouse Anti-Frog cav1 Antibody (MO-AB-02101H)


Cat: MO-AB-02101H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02101C
SpecificityThis antibody binds to Frog cav1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Product OverviewThis product is a mouse antibody against cav1. It can be used for cav1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaveolin; cav1; Cav-1
UniProt IDQ8JHX1
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MGIILNAASCHSSHPIPIYGGTAALTVTCLFSPSLSPCPSRSLQGVLYTTPVIREHGNIYKPNNKTMADDFLTETEVRDSHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKTSFTTFTVTKYWFYRLLSAIFGIPLSLIWGIFFAILSFLHIWAVVPCIRSYLIEIQFLSRVYSIGVHTLFDPWFEAMGKMLSFIKISLPQRSVGDYY.
See other products for " CAV1 "
MO-AB-43914WMouse Anti-Horse CAV1 Antibody (MO-AB-43914W)
MO-AB-24517HMouse Anti-Rat Cav1 Antibody (MO-AB-24517H)
CBMOAB-01096HCBMouse Anti-C. elegans CAV1 Antibody (CBMOAB-01096HCB)
MO-AB-29347WMouse Anti-Dog CAV1 Antibody (MO-AB-29347W)
MO-AB-00995YMouse Anti-Chicken CAV1 Antibody (MO-AB-00995Y)
MO-AB-14467YMouse Anti-Sheep CAV1 Antibody (MO-AB-14467Y)
MO-AB-09069WMouse Anti-Cat CAV1 Antibody (MO-AB-09069W)
MO-AB-07450YMouse Anti-Rabbit CAV1 Antibody (MO-AB-07450Y)
MO-AB-09559RMouse Anti-Cattle CAV1 Antibody (MO-AB-09559R)
MO-AB-23752WMouse Anti-Chimpanzee CAV1 Antibody (MO-AB-23752W)
For Research Use Only | Not For Clinical Use.
Online Inquiry