Mouse Anti-Frog cebpb Antibody (MO-AB-02306H)


Cat: MO-AB-02306H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02306C
SpecificityThis antibody binds to Frog cebpb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Product OverviewThis product is a mouse antibody against cebpb. It can be used for cebpb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCAAT/enhancer-binding beta protein; cebpb; c/ebp beta
UniProt IDQ9YH08
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: MHRLPQWDQAAACLPPPPGIRSMDYYDSDYLAGLVGKVPRRVPRGCPGSDSSIGDHERAIDFSPYLEPPAGALGAGSPSAAPPGDFLSDLLGADEYKCGRKGALEYSSGWERTGGVPQLGETKVEPVFESLEPYKGPGREDNAMQSPYSVRAYLGYQTVPSGSSGNLSSASSSSSPPGTPNPLDSKSEGPSGASGTGYRKSGSGKAKKSLDKQSNDYKLRRERNNIAVRKSRDKAKIRNMETQHKVLELSAENERLQKRVEQLSRELGTLRNLFKQVPEPLLAVTGRC.
For Research Use Only | Not For Clinical Use.
Online Inquiry