Mouse Anti-Frog cebpd Antibody (MO-AB-02307H)


Cat: MO-AB-02307H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02307C
SpecificityThis antibody binds to Frog cebpd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11.
Product OverviewThis product is a mouse antibody against cebpd. It can be used for cebpd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC398730 protein; cebpd; LOC398730
UniProt IDQ566F4
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MSLEARCLSPYAAWYMEPTNFYEQRLSGSPAPYKPRGMCEEPEAAVGTGGTLVELSAAPAMYDDESAIDFSSYIDSMASVPNLELCNDELFADLFNSSKAVGERQEGDYLMSGLLAAPHCPPGPAKVQLKQEPEWSDSDMSSSLPNQIAACAQTSMSLQPTPPTSPEPSTSACPSPAASSGSCGKDRSGKKCTDRYSPEYRQRRERNNIAVRKSRDKAKRRNVDMQQRLLELSSENEKLHKKIELLTRDLSSLRHFFKQLPPAATGPFLPSLTGIDCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry