Mouse Anti-Frog cyba Antibody (MO-AB-02775H)


Cat: MO-AB-02775H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02775C
SpecificityThis antibody binds to Frog cyba.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBA (Cytochrome B-245 Alpha Chain) is a Protein Coding gene. Diseases associated with CYBA include Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-Negative and Chronic Granulomatous Disease. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and SH3 domain binding.
Product OverviewThis product is a mouse antibody against cyba. It can be used for cyba detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80750 protein; cyba; MGC80750
UniProt IDQ6AZJ1
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: MGQIEWAMWANEQALASGLILLAGGIIAVAGQFKGWEFGAYGIAAGAFITLLEYPRSKRKKGSTMERCGQKYLAAVVKVFGPLTRNYYVRAILHAGLAVPGGFILATILGTVCLGIASIIYFLAAIRGEEWRYMEKQAEPKPRPGETIKRPPENPPPRPPAEVRRKQADEVSAEGGHVNPIPVTDNV.
See other products for " cyba "
MO-AB-29981WMouse Anti-Dog cyba Antibody (MO-AB-29981W)
MO-AB-25232HMouse Anti-Rat Cyba Antibody (MO-AB-25232H)
MO-AB-41499WMouse Anti-Guinea pig CYBA Antibody (MO-AB-41499W)
MO-AB-07766YMouse Anti-Rabbit CYBA Antibody (MO-AB-07766Y)
MO-AB-03584WMouse Anti-Rhesus CYBA Antibody (MO-AB-03584W)
CBMOAB-40203FYAMouse Anti-Rhesus CYBA Antibody (CBMOAB-40203FYA)
CBMOAB-72539FYAMouse Anti-Zebrafish cyba Antibody (CBMOAB-72539FYA)
MO-AB-53802WMouse Anti-Marmoset CYBA Antibody (MO-AB-53802W)
MO-AB-18162WMouse Anti-Chimpanzee CYBA Antibody (MO-AB-18162W)
MO-AB-11006RMouse Anti-Cattle CYBA Antibody (MO-AB-11006R)
For Research Use Only | Not For Clinical Use.
Online Inquiry