Mouse Anti-Frog CYP11B1 Antibody (MO-AB-02781H)


Cat: MO-AB-02781H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02781C
SpecificityThis antibody binds to Frog CYP11B1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP11B1 (Cytochrome P450 Family 11 Subfamily B Member 1) is a Protein Coding gene. Diseases associated with CYP11B1 include Adrenal Hyperplasia, Congenital, Due To Steroid 11-Beta-Hydroxylase Deficiency and Hyperaldosteronism, Familial, Type I. Among its related pathways are superpathway of steroid hormone biosynthesis and Aldosterone synthesis and secretion. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP11B2.
Product OverviewThis product is a mouse antibody against CYP11B1. It can be used for CYP11B1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSteroid 11-beta-hydroxylase protein; CYP11B1
UniProt IDQ71ME8
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: FAFGPIYRENLGTHSSVNIIHPHDVARLFQSEGIFPRRMGIGVWAAHRDLRNHKCGVFLLNGEEWRSDWLILNKEVLSLAGVKKFLPFLDEVANDFVSFLMRRINKNTRGTLTVDLYADLFRFTMEASGYVLYGLRLGLLEEHPNEDSLRFIRAVETMIKTTLPLLYLPHQLLRLMDSSLWIQHMEAWDIIFQQTDRCIQNIYQEFCLGQERGYSGIMAELLLQGELPLDSIKANVTELMAGGVDTTAMPLLFTLFELARNPITS.
For Research Use Only | Not For Clinical Use.
Online Inquiry