Mouse Anti-Frog cyp3a5 Antibody (MO-AB-02811H)


Cat: MO-AB-02811H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02811C
SpecificityThis antibody binds to Frog cyp3a5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP3A5 (Cytochrome P450 Family 3 Subfamily A Member 5) is a Protein Coding gene. Diseases associated with CYP3A5 include Hypertension, Essential and Tacrolimus Dose Selection. Among its related pathways are Tamoxifen Pathway, Pharmacokinetics and Vinka Alkaloid Pathway, Pharmacokinetics. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP3A4.
Product OverviewThis product is a mouse antibody against cyp3a5. It can be used for cyp3a5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC495363 protein; cyp3a5; LOC495363
UniProt IDQ5U557
Protein RefseqThe length of the protein is 510 amino acids long.
The sequence is show below: MTFLPDFSMETWTLLVLLLTLLAYYAIWPYRLFKRHGIPGPTPIPFIGTFLGNRNGIMEFDMECFKKYGNVWGFYDGPKPLLAIVDPVIIKNIMIKECYTNFTNRRDFGLSGPLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPVMKHYGELLVKNIQKKIDNKEPLNMKYIFGSYSMDTILSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLLTILCPFLVPLLDKMNFCFLSLKILNFFKDAVASIKKKRQKDIHEDRVDFLQLMVDAQNNEGDSVPEGEKQRYKELSDDEILAQSLIFIMAGYETTSTTLMFLAYNIAMHPDVQSRLEEEIDTLLPNKAPPTYEALMKMEYMDMVINETMRLFPSAIRIDRVCKKTMEINGVTIPAGVVIVVPLFVLHLNPEVWPEPEKFQPERFSKENQKNQDPYSFLPFGTGPRNCIGMRFALVNMKLALTLLLQNFRFEKCEDTPDPLNICTKGYLKPTKPIILKLVPKTAQTMKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry