Mouse Anti-Frog fa2h Antibody (MO-AB-03429H)


Cat: MO-AB-03429H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO03429C
SpecificityThis antibody binds to Frog fa2h.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.
Product OverviewThis product is a mouse antibody against fa2h. It can be used for fa2h detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC398669 protein; fa2h; LOC398669
UniProt IDQ5XGP9
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MASRRVSPVELRDKCSAGKCWVLVGNKVYDVSAFVNLHPGGERLLQDRAGKDIQADLNGAPHRHSENARRWLEQYYVGELEPQEQKPQNLKEKAQQYSSATDHKDVSTGIQFKTFSPETDLVDWEKPLLWQVGHLREKYDEWVHQPINRPIRLFHSDFVESCSKTAWYIVLSVWVPVVLYLSWYCLTELAQGNTRIFSSFTKDYSVPVPVFFFFPLFLIGVLIWTLMEYAIHRFVFHMNPPASNYYLITLHFMLHGQHHKAPFDSSRLVFPPVPASFVIIPLYILVQLIFPIPVGLSIFVGGLFGYVAYDMTHYYLHYGSPSKGSYLAWLKSYHVRHHFEHQKSGFGITSTLWDRPFNTLIPEDKDKDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry