Mouse Anti-Frog faslg Antibody (MO-AB-03497H)


Cat: MO-AB-03497H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO03497C
SpecificityThis antibody binds to Frog faslg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described.
Product OverviewThis product is a mouse antibody against faslg. It can be used for faslg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFasl protein; faslg; Fasl
UniProt IDB6F0V6
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MQQNMRYAQPSVFWMDPCRNPPLPSQVNMPLPPPFPDFRKKRRKDGTCTYLLIMFLLVLLALFGVGLGTYKIIELQRELDIVKEISGDKELPPALEKLIGLNKHPVEKKESKCAAHVTGKEGSTLPLAWEETFGRAFTSGIQYKNRGLVVNQTGLYFLYTSIYFRSTSCQSKELSHTVFKKSKRYPGELTLMKNTEYQYCTSNNKWGRHSYLGALFNLTTEETLYVNVSDIKLVSFDESRTFFGLYKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry