Mouse Anti-Frog mob4 Antibody (MO-AB-05252H)


Cat: MO-AB-05252H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05252C
SpecificityThis antibody binds to Frog mob4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.
Product OverviewThis product is a mouse antibody against mob4. It can be used for mob4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC496323 protein; mob4; LOC496323
UniProt IDQ5HZR7
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MALCLNQVFNKDRTFRPRKKFEPGTQRFELYKKAQASLKSGLDLKTVVQLPPGENINDWIAVHVVDFFNRINLIYGTMSEFCTERSCPIMCGGLKYEYRWQDDNKYKRPTKVSAPLYMNMLMEWIETLINNEDIFPTRMGVPFPKNFQQVCNKILTRLFRVFVHVYIHHFDAIISVGAEAHVNTCYKHFYYFITEFSLVNHRELEPLKEMTEKICH.
For Research Use Only | Not For Clinical Use.
Online Inquiry