Mouse Anti-Frog mrps9 Antibody (MO-AB-05330H)


Cat: MO-AB-05330H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05330C
SpecificityThis antibody binds to Frog mrps9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein.
Product OverviewThis product is a mouse antibody against mrps9. It can be used for mrps9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMrps9 protein; mrps9
UniProt IDQ0IH14
Protein RefseqThe length of the protein is 384 amino acids long.
The sequence is show below: MAVVCRGAGLSAVLRAAGTCSRKSTLTAGACIEASRLIHNSAAVHRKNVAAPGCEKYTEAFIKKQIEEYNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFDKKARPIMKHPEDIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHELYGKLLSIQQYEDQIRSKGLYSEDKRQMDLIGSRWLIKEELEEMLVEKLSDQDYLHFLQMLERLLILPYCSIEEEYVLKFRKNLEVQSKKQVVNPLQYDEHGRAFSTGEGKRKTAQATVMLHETGNGTVVVNGVNYSEYFTVLQDREQLMFPIQFLNRLGKHNLECTVAGGGKSSQAGAIRLATARALLSFVSENEIEAMRQAGLLTTDPRVKERKKPGQEGARRKFTWKKR.
See other products for " MRPS9 "
CBMOAB-06866HCBMouse Anti-C. elegans MRPS9 Antibody (CBMOAB-06866HCB)
CBMOAB-02434CRMouse Anti-Yeast MRPS9 Antibody (CBMOAB-02434CR)
MO-AB-59411WMouse Anti-Marmoset MRPS9 Antibody (MO-AB-59411W)
CBMOAB-24785FYAMouse Anti-D. melanogaster Mrps9 Antibody (CBMOAB-24785FYA)
CBMOAB-87479FYAMouse Anti-Zebrafish mrps9 Antibody (CBMOAB-87479FYA)
MO-AB-16076RMouse Anti-Cattle MRPS9 Antibody (MO-AB-16076R)
MO-AB-10853WMouse Anti-Chimpanzee MRPS9 Antibody (MO-AB-10853W)
For Research Use Only | Not For Clinical Use.
Online Inquiry