Mouse Anti-Frog nat8 Antibody (MO-AB-05477H)


Cat: MO-AB-05477H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05477C
SpecificityThis antibody binds to Frog nat8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
Product OverviewThis product is a mouse antibody against nat8. It can be used for nat8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC81154 protein; nat8b; MGC81154
UniProt IDQ6NU83
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MSDYNIRGYKDSDYETARELFSAGMNEYVPPVCIHVLKQPWVLFVLTCMFLCLLVSSKSLILPVLAVTLALALGRQLLGYCWSMYIDHCLKEDLRDISKTYMQSEGSYFWVAEADEIVVGTVAAKPSDEKREELVLKRMSVRKDFRGLGIGKALSREVLSFARQNGYRSVILNTLMVQHEAQRMYESVGFKKYIEFVLPTVYGKLINFTISKYRYDILPGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry