Mouse Anti-Frog nup50 Antibody (MO-AB-05834H)


Cat: MO-AB-05834H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05834C
SpecificityThis antibody binds to Frog nup50.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against nup50. It can be used for nup50 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC503671 protein; LOC503671
UniProt IDQ6DEC7
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: MAKRIADKELTDRNWDQEEEEEDAGMFSVASQEVLKTRAIKKAKRRNAGNESESGGAFKGFKGLFLVTGGSLSSFGNGSPAKPSEGLSNGTSTSLFINLKPQSKPTFGSAFTNRPLLGTAEKSTNGEKPLSSSGAALSKPGNLEYNKQLTSLNCSVRDWIVKHVNANPLCDLTPIFKDYEKHLSAIEQKYGASSESGSESDGAAQTKTIPNLSSGKTVSIATFSFGNKDKAPEAPTKTPPDSKPQAAPTFNFGQKVDSSTLGLISSGGAPNFSFSIGAPSLFGKNNGSTASSSSSQESEPSGKTEEKGEGEEEEEPPKEVIQEIKEDDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPVENKKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMIVCVPNPPVDEKNPTVPVTLLVRVKSAEDADQLHKILLEKKEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry