Mouse Anti-Frog pdpk1 Antibody (MO-AB-06157H)


Cat: MO-AB-06157H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO06157C
SpecificityThis antibody binds to Frog pdpk1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay couple lipid signals to the activation-loop phosphorylation of several protein kinases of the so-called AGC kinase family. Interacts via its pleckstrin homology domain with phosphatidic acid, PtdIns3P and PtdIns(3,4)P2 and to a lesser extent with PtdIns(4,5)P2 and PtdIns4P. May play a general role in signaling processes controlling the pathogen/stress response, polar auxin transport and development. Transphosphorylates the AGC protein kinases OXI1/AGC2-1, PK1/S6K1, PK19/S6K2 and PID resulting in their activation.
Product OverviewThis product is a mouse antibody against pdpk1. It can be used for pdpk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC82080 protein; pdpk1; MGC82080
UniProt IDQ6GM85
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: MDVKAVESRTNPNPLPHPGQQEQHPRKKRAQDFKFGKILGEGSFSTVVLAKELTTGREFAIKILQKRHILKENKVLYVTREKGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry