Mouse Anti-Frog pdpk1 Antibody (MO-AB-06157H)
Cat: MO-AB-06157H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Frog (Xenopus laevis) |
Clone | MO06157C |
Specificity | This antibody binds to Frog pdpk1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | May couple lipid signals to the activation-loop phosphorylation of several protein kinases of the so-called AGC kinase family. Interacts via its pleckstrin homology domain with phosphatidic acid, PtdIns3P and PtdIns(3,4)P2 and to a lesser extent with PtdIns(4,5)P2 and PtdIns4P. May play a general role in signaling processes controlling the pathogen/stress response, polar auxin transport and development. Transphosphorylates the AGC protein kinases OXI1/AGC2-1, PK1/S6K1, PK19/S6K2 and PID resulting in their activation. |
Product Overview | This product is a mouse antibody against pdpk1. It can be used for pdpk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MGC82080 protein; pdpk1; MGC82080 |
UniProt ID | Q6GM85 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MDVKAVESRTNPNPLPHPGQQEQHPRKKRAQDFKFGKILGEGSFSTVVLAKELTTGREFAIKILQKRHILKENKVLYVTREKGK. |
See other products for " PDPK1 "
MO-AB-17730R | Mouse Anti-Cattle PDPK1 Antibody (MO-AB-17730R) |
MO-AB-61258W | Mouse Anti-Marmoset PDPK1 Antibody (MO-AB-61258W) |
MO-AB-13460W | Mouse Anti-Chimpanzee PDPK1 Antibody (MO-AB-13460W) |
CBMOAB-54195FYA | Mouse Anti-Rhesus PDPK1 Antibody (CBMOAB-54195FYA) |
CBMOAB-38496FYC | Mouse Anti-Arabidopsis PDPK1 Antibody (CBMOAB-38496FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry