Mouse Anti-Frog phb Antibody (MO-AB-06223H)


Cat: MO-AB-06223H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO06223C
SpecificityThis antibody binds to Frog phb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against phb. It can be used for phb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC53103 protein; phb
UniProt IDQ7ZYF7
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: MAARLLETIGKLGLGLAVAGGVVNSALYNVDAGHNAVMFDRFRGVQDVVTGEGTHFLIPWVQKPIIFDCRSRPRQVPVVTGSKDLQNVNITLRILFRPMANQLPRIFTTIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLMERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVSQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIASSLADAGDGLIELRKLEAAEDIAYQLSRARNVTYLPSGQSTLLQLPQ.
See other products for " PHB "
MO-AB-03407YMouse Anti-Chicken PHB Antibody (MO-AB-03407Y)
CBMOAB-92376FYAMouse Anti-Zebrafish phb Antibody (CBMOAB-92376FYA)
MO-AB-17859RMouse Anti-Cattle PHB Antibody (MO-AB-17859R)
MO-AB-07792WMouse Anti-Cat PHB Antibody (MO-AB-07792W)
MO-AB-10727WMouse Anti-Chimpanzee PHB Antibody (MO-AB-10727W)
MO-NAB-00392WRabbit Anti-PHB Antibody (AA 150-190)
MO-DKB-03635WRabbit Anti-PHB (N-terminal, clone ms2109-043) Antibody (Cat MO-DKB-03635W)
CBMOAB-00270FYARabbit Anti-Mouse PHB Antibody (CBMOAB-00270FYA)
MO-DKB-00806WRabbit Anti-PHB Antibody (MO-DKB-00806W)
For Research Use Only | Not For Clinical Use.
Online Inquiry