Mouse Anti-Frog rcn2 Antibody (MO-AB-07007H)


Cat: MO-AB-07007H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07007C
SpecificityThis antibody binds to Frog rcn2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against rcn2. It can be used for rcn2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRcn2-prov protein; rcn2; rcn2-prov
UniProt IDQ6DCV4
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MKTCTYWCFFTMCFAASLAHQHDEHYENGEHNAEYDKKLFLGGEEEAEEFTELSSEDQLKRLKLIIRRIDTDSDGYLTEEELSSWIQKSFRHYILEDTKEHFADIDKDGDGIVTWDEYNMHLYDRIIDYDENTVLEDEEEESFRLIHMKDKRRFDHADTDKIPGLNLTEFTDFEHPEETDHMSEFVIEGALEEHDEDGDGFVSLEEYLGDYTQDSGAVEDPHWLIVEKDRFVNDYDKDGDGRLNPTELLSWIVPNNLGISQEEAIHLMTEMDKNEDQRLSEEEILQNKDIFLTSEATDYGRQLQDKQFYHDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry