Mouse Anti-Frog rfc2 Antibody (MO-AB-07056H)


Cat: MO-AB-07056H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07056C
SpecificityThis antibody binds to Frog rfc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2.
Product OverviewThis product is a mouse antibody against rfc2. It can be used for rfc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC81391 protein; rfc2; MGC81391
UniProt IDQ6NRU3
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MDVEMVESAAGESGTKQAAPATKSLAVTYELPWVEKYRPLKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPTMKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLARLMDVVEKEKVQCTDDGLEAIVFTAQGDMRQALNNVQSTCAGFGFVNSTNVFKVCDEPHPLLVKEMLQHCVNANIDEAYKIVAHLWKLGYSPEDIIGNIFRVCKTFQMPEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTAVSTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry