Mouse Anti-Frog rfc4 Antibody (MO-AB-07058H)


Cat: MO-AB-07058H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07058C
SpecificityThis antibody binds to Frog rfc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.
Product OverviewThis product is a mouse antibody against rfc4. It can be used for rfc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRFC2 protein; Replication factor C p37 subunit; rfc4; RFC2
UniProt IDQ76LD2
Protein RefseqThe length of the protein is 363 amino acids long.
The sequence is show below: MQAFLKGGTSIGTKPVKDKASASGTGSTGESKKQKPIPWVEKYRPKCVDEVAFQDEVVAVLKKSLQGADLPNLLFYGPPGTGKTSTILAASRELYGPELFRQRVLELNASDERGIQVVREKVKNFAQLTVGGTRSDGKPCPPFKIIILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLADKIQTQRLLSICEKENVQITNEAISCLVEVSEGDLRKAITFLQSAARLTRGKEITEEIVTEIAGVVPKETLDSVLVVCQSGSFEKLENFVKDLINNGHAATQLVNQLHDVILERGDLTDKQKAFITEKLADVDKCLTDGADEYLQMLGLFAVVMQQMTQNS.
See other products for " RFC4 "
MO-AB-22062WMouse Anti-Chimpanzee RFC4 Antibody (MO-AB-22062W)
CBMOAB-29383FYAMouse Anti-D. melanogaster Rfc4 Antibody (CBMOAB-29383FYA)
MO-AB-63211WMouse Anti-Marmoset RFC4 Antibody (MO-AB-63211W)
CBMOAB-40001FYCMouse Anti-Arabidopsis RFC4 Antibody (CBMOAB-40001FYC)
CBMOAB-03349CRMouse Anti-Yeast RFC4 Antibody (CBMOAB-03349CR)
CBMOAB-89074FYBMouse Anti-Rice RFC4 Antibody (CBMOAB-89074FYB)
CBMOAB-09066HCBMouse Anti-C. elegans RFC4 Antibody (CBMOAB-09066HCB)
CBMOAB-95742FYAMouse Anti-Zebrafish rfc4 Antibody (CBMOAB-95742FYA)
MO-AB-16573HMouse Anti-Malaria parasite rfc4 Antibody (MO-AB-16573H)
For Research Use Only | Not For Clinical Use.
Online Inquiry